General Information

  • ID:  hor005338
  • Uniprot ID:  P01196
  • Protein name:  Corticotropin
  • Gene name:  POMC
  • Organism:  Struthio camelus (Common ostrich)
  • Family:  POMC family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Struthio (genus), Struthionidae (family), Struthioniformes (order), Palaeognathae (superorder), Aves (class), Coelurosauria, Theropoda, Saurischia, Dinosauria, Archosauria, Archelosauria, Sauria, Sauropsida, Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  SYSMEHFRWGKPVGRKRRPVKVYPNGVQEETSEGFPLEF
  • Length:  39(1-39)
  • Propeptide:  SYSMEHFRWGKPVGRKRRPVKVYPNGVQEETSEGFPLEF
  • Signal peptide:  NA
  • Modification:  T13 Valine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates the adrenal glands to release cortisol.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P01196-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-P01196-F1.pdbhor005338_AF2.pdbhor005338_ESM.pdb

Physical Information

Mass: 530415 Formula: C210H315N59O58S
Absent amino acids: ACDI Common amino acids: E
pI: 9.86 Basic residues: 8
Polar residues: 11 Hydrophobic residues: 9
Hydrophobicity: -105.38 Boman Index: -10181
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 39.74
Instability Index: 6638.97 Extinction Coefficient cystines: 8480
Absorbance 280nm: 223.16

Literature

  • PubMed ID:  208539
  • Title:  Adrenocorticotropin 53. The amino acid sequence of the hormone from the ostrich pituitary gland.